TMEM93 antibody
| Name | TMEM93 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA335434 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Pig, Rat |
| Antigen | The immunogen for Anti-TMEM93 Antibody: synthetic peptide directed towards the N terminal of human TMEM93. Synthetic peptide located within the following region: AAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYG. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | EMC6 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-TMEM93 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Jurkat cell lysate.EMC6 is supported by BioGPS gene expression data to be expressed in Jurkat