Tmem102 antibody
| Name | Tmem102 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA334134 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Horse, Guinea Pig, Mouse, Rabbit, Rat |
| Antigen | The immunogen for Anti-Tmem102 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: KDFVFALLGLVHRQDPRFPPQAELLLLRGGIREGSLDLGHAPLGPYSRGP. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | Tmem102 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-Tmem102 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse liver