Name | TMEM104 antibody |
---|---|
Supplier | Acris Antibodies |
Catalog | TA342034 |
Prices | $325.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Rabbit, Rat |
Antigen | The immunogen for anti-TMEM104 antibody: synthetic peptide directed towards the middle region of human TMEM104. Synthetic peptide located within the following region: GDLAIYAAAVPFSLMQVTCSATGNDSCGVEADTKYNDTDRCWGPLRRVDA. |
Description | Rabbit Polyclonal |
Gene | TMEM104 |
Supplier Page | Shop |