TMEM104 antibody
| Name | TMEM104 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA342034 |
| Prices | $325.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Rabbit, Rat |
| Antigen | The immunogen for anti-TMEM104 antibody: synthetic peptide directed towards the middle region of human TMEM104. Synthetic peptide located within the following region: GDLAIYAAAVPFSLMQVTCSATGNDSCGVEADTKYNDTDRCWGPLRRVDA. |
| Description | Rabbit Polyclonal |
| Gene | TMEM104 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-TMEM104 Antibody Titration: 5.0 ug/ml; Positive Control: Jurkat cell lysate