TMEM118 / RNFT2 antibody
| Name | TMEM118 / RNFT2 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA339630 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for anti-TMEM118 antibody: synthetic peptide directed towards the N terminal of human TMEM118. Synthetic peptide located within the following region: HGGHRGGSLLQHVGGDHRGHSEEGGDEQPGTPAPALSELKAVICWLQKGL. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | RNFT2 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-RNFT2 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate