TMEM231 antibody

Name TMEM231 antibody
Supplier Acris Antibodies
Catalog TA335940
Prices $325.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC-P WB
Species Reactivities Bovine, Dog, Guinea Pig, Human, Pig, Rabbit, Rat
Antigen The immunogen for Anti-FLJ22167 Antibody: synthetic peptide directed towards the N terminal of human FLJ22167. Synthetic peptide located within the following region: CHEAPRARSARAGLPNRLPTALFNSGFWLKRSSYEEQPTVRFQHQVLLVA.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene TMEM231
Supplier Page Shop

Product images