Name | TMEM261 / C9orf123 antibody |
---|---|
Supplier | Acris Antibodies |
Catalog | TA333580 |
Prices | $325.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rabbit |
Antigen | The immunogen for Anti-C9orf123 Antibody is: synthetic peptide directed towards the C-terminal region of Human C9orf123. Synthetic peptide located within the following region: MGAGGYVYWVARKPMKMGYPPSPWTITQMVIGLSIATWGIVVMADPKGKA. |
Purity/Format | Affinity Purified |
Description | Rabbit Polyclonal |
Gene | TMEM261 |
Supplier Page | Shop |