TOMM40L antibody
| Name | TOMM40L antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA338719 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for anti-TOMM40L antibody: synthetic peptide directed towards the middle region of human TOMM40L. Synthetic peptide located within the following region: LNAQVLLLLAERLRAKAVFQTQQAKFLTWQFDGEYRGDDYTATLTLGNPD. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | TOMM40L |
| Supplier Page | Shop |
Product images
WB Suggested Anti-TOMM40L Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate