TPRG1 antibody
| Name | TPRG1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA333367 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Human |
| Antigen | The immunogen for Anti-FAM79B Antibody: synthetic peptide directed towards the N terminal of human FAM79B. Synthetic peptide located within the following region: DPMPRQISRQSSVTESTLYPNPYHQPYISRKYFATRPGAIETAMEDLKGH. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | TPRG1 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-FAM79B Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: HepG2 cell lysate