TRAPPC2L antibody
| Name | TRAPPC2L antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA345055 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Guinea Pig, Pig, Zebrafish |
| Antigen | The immunogen for anti-TRAPPC2L antibody: synthetic peptide directed towards the N terminal of human TRAPPC2L. Synthetic peptide located within the following region: MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKAL. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | TRAPPC2L |
| Supplier Page | Shop |
Product images
WB Suggested Anti-TRAPPC2L Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human heart