TRIM43B antibody
| Name | TRIM43B antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA335888 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for Anti-TRIM43B Antibody is: synthetic peptide directed towards the N-terminal region of Human TRIM43B. Synthetic peptide located within the following region: CREPSPKMDFKTNILLKNLVTIARKASLWQFLSSEKQICGTHRQTKKMFC. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | TRIM43B |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: TRIM43B; Sample Tissue: Fetal Heart lysates; Antibody Dilution: 1.0 ug/ml