TRIM49C antibody
| Name | TRIM49C antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA332153 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for Anti-TRIM49C Antibody is: synthetic peptide directed towards the N-terminal region of Human TRIM49C. Synthetic peptide located within the following region: QCSECTKSTEQINLKTNIHLKKMASLARKVSLWLFLSSEEQMCGTHRETK. |
| Description | Rabbit Polyclonal |
| Gene | TRIM49C |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: TRIM49C; Sample Tissue: Jurkat Whole cell lysates; Antibody Dilution: 1.0ug/ml