Name | TRIM70 / TRIM16L antibody |
---|---|
Supplier | Acris Antibodies |
Catalog | TA330798 |
Prices | $325.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Bovine, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat |
Antigen | The immunogen for Anti-TRIM16L antibody is: synthetic peptide directed towards the N-terminal region of Human TRIM16L. Synthetic peptide located within the following region: RKAQANVMLFLEEKEQAALSQANGIKAHLEYRSAEMEKSKQELETMAAIS. |
Description | Rabbit Polyclonal |
Gene | TRIM16L |
Supplier Page | Shop |