TRIM70 / TRIM16L antibody
| Name | TRIM70 / TRIM16L antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA330798 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat |
| Antigen | The immunogen for Anti-TRIM16L antibody is: synthetic peptide directed towards the N-terminal region of Human TRIM16L. Synthetic peptide located within the following region: RKAQANVMLFLEEKEQAALSQANGIKAHLEYRSAEMEKSKQELETMAAIS. |
| Description | Rabbit Polyclonal |
| Gene | TRIM16L |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: TRIM16L; Sample Tissue: Fetal Lung lysates; Antibody Dilution: 1.0ug/ml