TTC22 antibody
| Name | TTC22 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA330801 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat |
| Antigen | The immunogen for Anti-TTC22 antibody is: synthetic peptide directed towards the N-terminal region of Human TTC22. Synthetic peptide located within the following region: AARCLAEQGYAHGFDVGCASPEERARGLAAGIALYDKALGYGQQIPMEEK. |
| Description | Rabbit Polyclonal |
| Gene | TTC22 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: TTC22; Sample Tissue: Placenta lysates; Antibody Dilution: 1.0ug/ml