TTC39C antibody
| Name | TTC39C antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA330808 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for Anti-TTC39C antibody is: synthetic peptide directed towards the middle region of Human TTC39C. Synthetic peptide located within the following region: NLLKIINLLGFPGDRLQGLSSLMYASESKDMKAPLATLALLWYHTVVRPF. |
| Description | Rabbit Polyclonal |
| Gene | TTC39C |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: TTC39C; Sample Tissue: Fetal Lung lysates; Antibody Dilution: 1.0ug/ml