TTLL10 antibody
| Name | TTLL10 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331616 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Rat, Yeast |
| Antigen | The immunogen for Anti-TTLL10 Antibody is: synthetic peptide directed towards the N-terminal region of Human TTLL10. Synthetic peptide located within the following region: ATIISSYCKSKGWQRIHDSRRDDYTLKWCEVKSRDSYGSFREGEQLLYQL. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | TTLL10 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: TTLL10; Sample Tissue: HepG2 Whole cell lysates; Antibody Dilution: 1.0ug/ml