U11/U12 snRNP 35 kDa protein antibody
| Name | U11/U12 snRNP 35 kDa protein antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA345994 |
| Prices | $325.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat |
| Antigen | The immunogen for anti-U1SNRNPBP antibody: synthetic peptide directed towards the N terminal of human U1SNRNPBP. Synthetic peptide located within the following region: RAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIR. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | SNRNP35 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-U1SNRNPBP Antibody Titration: 2.5 ug/ml; Positive Control: Jurkat cell lysate