| Name | Ubiquitin-fold modifier 1 (UFM1) antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA342603 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for anti-UFM1 antibody: synthetic peptide directed towards the middle region of human UFM1. Synthetic peptide located within the following region: LSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKH. |
| Description | Rabbit Polyclonal |
| Gene | UFM1 |
| Supplier Page | Shop |