UGT3A1 antibody

Name UGT3A1 antibody
Supplier Acris Antibodies
Catalog TA330975
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen The immunogen for Anti-UGT3A1 antibody is: synthetic peptide directed towards the N-terminal region of Human UGT3A1. Synthetic peptide located within the following region: WFSPEDHQKRIKKHFDSYIETALDGRKESEALVKLMEIFGTQCSYLLSRK.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene UGT3A1
Supplier Page Shop

Product images