UPK3BL antibody
| Name | UPK3BL antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA330895 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Horse, Human, Pig |
| Antigen | The immunogen for Anti-UPK3BL antibody is: synthetic peptide directed towards the C-terminal region of Human UPK3BL. Synthetic peptide located within the following region: PTKIGCNHPLPGPGPYRVKFLVMNDEGPVAETKWSSDTRLQQAQALRAVP. |
| Description | Rabbit Polyclonal |
| Gene | UPK3BL |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: UPK3BL; Sample Tissue: 721_B Whole Cell lysates; Antibody Dilution: 1.0ug/ml