Uromodulin-like 1 / UMODL1 antibody

Name Uromodulin-like 1 / UMODL1 antibody
Supplier Acris Antibodies
Catalog TA336183
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Human, Mouse, Pig, Rat
Antigen The immunogen for Anti-UMODL1 Antibody: synthetic peptide directed towards the middle region of human UMODL1. Synthetic peptide located within the following region: EMQLFIGDSPIPQNYSVSASDDVRIEVGLYRQKSNLKVVLTECWATPSSN.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene UMODL1
Supplier Page Shop

Product images