Name | USMG5 antibody |
---|---|
Supplier | Acris Antibodies |
Catalog | TA339625 |
Prices | $325.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Bovine, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat |
Antigen | The immunogen for anti-USMG5 antibody: synthetic peptide directed towards the N terminal of human USMG5. Synthetic peptide located within the following region: MAGPESDAQYQFTGIKKYFNSYTLTGRMNCVLATYGSIALIVLYFKLRSK. |
Purity/Format | Affinity Purified |
Description | Rabbit Polyclonal |
Gene | USMG5 |
Supplier Page | Shop |