USP17L5 antibody
| Name | USP17L5 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA338279 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for anti-USP17L5 antibody is: synthetic peptide directed towards the C-terminal region of Human USP17L5. Synthetic peptide located within the following region: EQQSSLLNLSSSTPTHQESMNTGTLASLRGRARRSKGKNKHSKRALLVCQ. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | USP17L5 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-USP17L5 Antibody; Titration: 1.0 ug/ml; Positive Control: Hela Whole Cell