USP54 antibody
| Name | USP54 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA334799 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Human, Rabbit |
| Antigen | The immunogen for anti-USP54 antibody is: synthetic peptide directed towards the C-terminal region of Human USP54. Synthetic peptide located within the following region: TPGPRRVDMPPDDDWRQSSYASHSGHRRTVGEGFLFVLSDAPRREQIRAR. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | USP54 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: USP54; Sample Tissue: THP-1 whole cell lysates; Antibody Dilution: 1.0 ug/ml