VCY antibody
| Name | VCY antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA338178 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Horse, Human |
| Antigen | The immunogen for anti-VCY antibody is: synthetic peptide directed towards the N-terminal region of Human VCY. Synthetic peptide located within the following region: PPAKAKETGKRKSSSQPSPSGPKKKTTKVAEKGEAVRGGRRGKKGAATKM. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | VCY |
| Supplier Page | Shop |
Product images
WB Suggested Anti-VCY Antibody; Titration: 1.0 ug/ml; Positive Control: Hela Whole Cell