VEPH1 antibody

Name VEPH1 antibody
Supplier Acris Antibodies
Catalog TA330818
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Antigen The immunogen for Anti-VEPH1 antibody is: synthetic peptide directed towards the C-terminal region of Human VEPH1. Synthetic peptide located within the following region: LPRAFEIFTDNKTYVFKAKDEKNAEEWLQCINVAVAQAKERESREVTTYL.
Description Rabbit Polyclonal
Gene VEPH1
Supplier Page Shop

Product images