VHLL antibody

Name VHLL antibody
Supplier Acris Antibodies
Catalog TA330819
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen The immunogen for Anti-VHLL antibody is: synthetic peptide directed towards the N-terminal region of Human VHLL. Synthetic peptide located within the following region: PWRAGNGVGLEAQAGTQEAGPEEYCQEELGAEEEMAARAAWPVLRSVNSR.
Description Rabbit Polyclonal
Gene VHLL
Supplier Page Shop

Product images