WBP5 antibody

Name WBP5 antibody
Supplier Acris Antibodies
Catalog TA335563
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Antigen The immunogen for Anti-WBP5 Antibody is: synthetic peptide directed towards the N-terminal region of Human WBP5. Synthetic peptide located within the following region: QKMEGKPENESEPKHEEEPKPEEKPEEEEKLEEEAKAKGTFRERLIQSLQ.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene WBP5
Supplier Page Shop

Product images