WBP5 antibody

Name WBP5 antibody
Supplier Acris Antibodies
Catalog TA345199
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Horse, Human, Pig, Rabbit, Rat
Antigen The immunogen for anti-WBP5 antibody: synthetic peptide directed towards the middle region of human WBP5. Synthetic peptide located within the following region: TFRERLIQSLQEFKEDIHNRHLSNEDMFREVDEIDEIRRVRNKLIVMRWK.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene WBP5
Supplier Page Shop

Product images