WDR31 antibody
| Name | WDR31 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA330822 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Guinea Pig, Human, Mouse, Rat |
| Antigen | The immunogen for Anti-WDR31 antibody is: synthetic peptide directed towards the middle region of Human WDR31. Synthetic peptide located within the following region: MWDLHGSSQPRQQLCGHAMVVTGLAVSPDSSQLCTGSRDNTLLLWDVVTG. |
| Description | Rabbit Polyclonal |
| Gene | WDR31 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: WDR31; Sample Tissue: ACHN Whole Cell lysates; Antibody Dilution: 1.0ug/ml