WDR55 antibody
| Name | WDR55 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA344973 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Human, Mouse, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for anti-WDR55 antibody: synthetic peptide directed towards the middle region of human WDR55. Synthetic peptide located within the following region: AKKLLLTASGDGCLGIFNIKRRRFELLSEPQSGDLTSVTLMKWGKKVACG. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | WDR55 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-WDR55 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Jurkat cell lysateWDR55 is supported by BioGPS gene expression data to be expressed in Jurkat