WDR59 antibody
| Name | WDR59 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA330823 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for Anti-WDR59 antibody is: synthetic peptide directed towards the N-terminal region of Human WDR59. Synthetic peptide located within the following region: APMKIRTEAPGNLRLYSGSPTRSEKEQVSISSFYYKERKSRRWKSKREGS. |
| Description | Rabbit Polyclonal |
| Gene | WDR59 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: WDR59; Sample Tissue: 293T Whole Cell lysates; Antibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that WDR59 is expressed in HEK293T