WWC2 / BOMB antibody

Name WWC2 / BOMB antibody
Supplier Acris Antibodies
Catalog TA330829
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rat, Yeast
Antigen The immunogen for Anti-WWC2 antibody is: synthetic peptide directed towards the C-terminal region of Human WWC2. Synthetic peptide located within the following region: RLLKQAEKQAEQSKEEQKQGLNAEKLMRQVSKDVCRLREQSQKVPRQVQS.
Description Rabbit Polyclonal
Gene WWC2
Supplier Page Shop

Product images