Name | WWC2 / BOMB antibody |
---|---|
Supplier | Acris Antibodies |
Catalog | TA330829 |
Prices | $325.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rat, Yeast |
Antigen | The immunogen for Anti-WWC2 antibody is: synthetic peptide directed towards the C-terminal region of Human WWC2. Synthetic peptide located within the following region: RLLKQAEKQAEQSKEEQKQGLNAEKLMRQVSKDVCRLREQSQKVPRQVQS. |
Description | Rabbit Polyclonal |
Gene | WWC2 |
Supplier Page | Shop |