XIRP2 / Beta-Xin antibody
| Name | XIRP2 / Beta-Xin antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA342503 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat |
| Antigen | The immunogen for anti-XIRP2 antibody: synthetic peptide directed towards the C terminal of human XIRP2. Synthetic peptide located within the following region: VEPPPRRPMSQKSEIHRANTSPSPPRSRSEQLVRLKDTTAKLSKGAIPCP. |
| Description | Rabbit Polyclonal |
| Gene | XIRP2 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-XIRP2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Hela cell lysate