XKR6 antibody

Name XKR6 antibody
Supplier Acris Antibodies
Catalog TA333456
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Antigen The immunogen for Anti-XKR6 Antibody is: synthetic peptide directed towards the middle region of Human XKR6. Synthetic peptide located within the following region: RTMYLGIQSQRRKEHQRRFYWAMMYEYADVNMLRLLETFLESAPQLVLQL.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene XKR6
Supplier Page Shop

Product images