YIF1A antibody
| Name | YIF1A antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA333737 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rat |
| Antigen | The immunogen for Anti-YIF1A Antibody is: synthetic peptide directed towards the N-terminal region of Human YIF1A. Synthetic peptide located within the following region: LFDDTSGGYSSQPGGYPATGADVAFSVNHLLGDPMANVAMAYGSSIASHG. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | YIF1A |
| Supplier Page | Shop |
Product images
WB Suggested Anti-YIF1A Antibody; Titration: 1.0 ug/ml; Positive Control: Jurkat Whole Cell