ZFP3 antibody

Name ZFP3 antibody
Supplier Acris Antibodies
Catalog TA341501
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Horse, Guinea Pig, Human
Antigen The immunogen for anti-ZFP3 antibody: synthetic peptide directed towards the N terminal of human ZFP3. Synthetic peptide located within the following region: TTEGVSAFATSGQNFLEILESNKTQRSSVGEKPHTCKECGKAFNQNSHLI.
Description Rabbit Polyclonal
Gene ZFP3
Supplier Page Shop

Product images