ZHX2 antibody
| Name | ZHX2 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331444 |
| Prices | $325.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat |
| Antigen | The immunogen for anti-ZHX2 antibody: synthetic peptide directed towards the C terminal of mouse ZHX2. Synthetic peptide located within the following region: SGIVDFVEVTVGEEDAISEKWGSWSRRVAEGTVERADSDSDSTPAEAGQA. |
| Description | Rabbit Polyclonal |
| Gene | Zhx2 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-ZHX2 Antibody Titration: 2.5ug/ml; ELISA Titer: 1:62500; Positive Control: SP2/0 cell lysate