ZNF14 antibody

Name ZNF14 antibody
Supplier Acris Antibodies
Catalog TA339217
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Dog, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Antigen The immunogen for anti-ZNF14 antibody: synthetic peptide directed towards the N terminal of human ZNF14. Synthetic peptide located within the following region: IYYQPFQRHERTHAGQKPYECKQCGKTFIYYQSFQKHAHTGKKPYECKQC.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene ZNF14
Supplier Page Shop

Product images