ZNF17 antibody
| Name | ZNF17 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA341544 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for anti-ZNF17 antibody: synthetic peptide directed towards the N terminal of human ZNF17. Synthetic peptide located within the following region: NLTCMQGGKDFTGDSDLQQQALHSGWKPHRDTHGVEAFQSGQNNYSCTQC. |
| Description | Rabbit Polyclonal |
| Gene | ZNF17 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-ZNF17 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: Human Small Intestine