ZNF233 antibody
| Name | ZNF233 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA341529 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | The immunogen for anti-ZNF233 antibody: synthetic peptide directed towards the middle region of human ZNF233. Synthetic peptide located within the following region: ERACKCDVYDKGFSQTSQLQAHQRGHSRDKTYKWEVSDRIFNRNSGLHQR. |
| Description | Rabbit Polyclonal |
| Gene | ZNF233 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-ZNF233 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: Human Thymus