ZNF235 antibody
| Name | ZNF235 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA333975 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Guinea Pig, Human, Mouse, Rabbit, Rat |
| Antigen | The immunogen for Anti-ZNF235 Antibody is: synthetic peptide directed towards the N-terminal region of HUMAN ZNF235. Synthetic peptide located within the following region: FRNLVSVGHQSFKPDMISQLEREEKLWMKELQTQRGKHSGDRNQNEMATL. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | ZNF235 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: ZNF235; Sample Tissue: Hela Whole Cell lysates; Antibody Dilution: 1.0 ug/ml