ZNF254 antibody
| Name | ZNF254 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA330891 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Human, Mouse, Rat |
| Antigen | The immunogen for Anti-ZNF254 antibody is: synthetic peptide directed towards the middle region of Human ZNF254. Synthetic peptide located within the following region: WSSTLTNHRKIYTEEKPYKCEEYNKSPKQLSTLTTHEIIHAGEKLYKCEE. |
| Description | Rabbit Polyclonal |
| Gene | ZNF254 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: ZNF254; Sample Tissue: HepG2 Whole Cell lysates; Antibody Dilution: 1.0ug/ml