ZNF254 antibody
| Name | ZNF254 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA339105 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for anti-ZNF254 antibody: synthetic peptide directed towards the middle region of human ZNF254. Synthetic peptide located within the following region: SKVFQCDKYLKVFYKFLNSNRPKIRHTEKKSFKCKKRVKLFCMLSHKTQH. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | ZNF254 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-ZNF254 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: 721_B cell lysate