Name | ZNF254 antibody |
---|---|
Supplier | Acris Antibodies |
Catalog | TA339105 |
Prices | $325.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human |
Antigen | The immunogen for anti-ZNF254 antibody: synthetic peptide directed towards the middle region of human ZNF254. Synthetic peptide located within the following region: SKVFQCDKYLKVFYKFLNSNRPKIRHTEKKSFKCKKRVKLFCMLSHKTQH. |
Purity/Format | Protein A purified |
Description | Rabbit Polyclonal |
Gene | ZNF254 |
Supplier Page | Shop |