ZNF304 antibody

Name ZNF304 antibody
Supplier Acris Antibodies
Catalog TA345292
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Human, Mouse, Pig, Rat
Antigen The immunogen for anti-ZNF304 antibody: synthetic peptide directed towards the N terminal of human ZNF304. Synthetic peptide located within the following region: MAAAVLMDRVQSCVTFEDVFVYFSREEWELLEEAQRFLYRDVMLENFALV.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene ZNF304
Supplier Page Shop

Product images