ZNF330 antibody
| Name | ZNF330 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331978 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Horse, Human, Mouse, Pig, Rabbit, Rat |
| Antigen | The immunogen for Anti-ZNF330 Antibody is: synthetic peptide directed towards the C-terminal region of Human ZNF330. Synthetic peptide located within the following region: DLSMSTRSLKFGRQTGGEEGDGASGYDAYWKNLSSDKYGDTSYHDEEEDE. |
| Description | Rabbit Polyclonal |
| Gene | ZNF330 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: ZNF330; Sample Tissue: Fetal Heart lysates; Antibody Dilution: 1.0ug/ml