Name | ZNF362 antibody |
---|---|
Supplier | Acris Antibodies |
Catalog | TA339803 |
Prices | $325.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Bovine, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish |
Antigen | The immunogen for Anti-ZNF362 antibody is: synthetic peptide directed towards the N-terminal region of Human ZNF362. Synthetic peptide located within the following region: PSQLDNLVLINKIKEQLMAEKIRPPHLPPTSASSQQPLLVPPAPAESSQA. |
Purity/Format | Affinity Purified |
Description | Rabbit Polyclonal |
Gene | ZNF362 |
Supplier Page | Shop |