ZNF362 antibody
| Name | ZNF362 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA339804 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for Anti-ZNF362 antibody is: synthetic peptide directed towards the C-terminal region of Human ZNF362. Synthetic peptide located within the following region: KHAKAYCCSMCGRAYTSETYLMKHMSKHTVVEHLVSHHSPQRTESPGIPV. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | ZNF362 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: ZNF362; Sample Tissue: OVCAR-3 Whole cell lysates; Antibody Dilution: 1.0 ug/ml ZNF362 is supported by BioGPS gene expression data to be expressed in OVCAR3