ZNF404 antibody
| Name | ZNF404 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA329724 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for anti-ZNF404 antibody: synthetic peptide directed towards the middle region of human ZNF404. Synthetic peptide located within the following region: YVCKECKKAFRSISGLSQHKRIHTGEKPYECKECDKAFNRSDRLTQHETI. |
| Description | Rabbit Polyclonal |
| Gene | ZNF404 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-ZNF404 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: MCF7 cell lysate