ZNF468 antibody
| Name | ZNF468 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA339840 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Horse, Human, Mouse, Rat, Zebrafish |
| Antigen | The immunogen for anti-ZNF468 antibody: synthetic peptide directed towards the middle region of human ZNF468. Synthetic peptide located within the following region: FIHKALHTGEKPYECEECDKVFSRKSHLERHKRIHTGEKPYKCKVCDEAF. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | ZNF468 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-ZNF468 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: PANC1 cell lysate