ZNF506 antibody

Name ZNF506 antibody
Supplier Acris Antibodies
Catalog TA342456
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Human, Mouse, Pig, Rat, Zebrafish
Antigen The immunogen for anti-ZNF506 antibody is: synthetic peptide directed towards the C-terminal region of Human ZNF506. Synthetic peptide located within the following region: HTGEKPYKCEECGKAFTAFSTLTEHKIIHTGEKPYKCEECGKAFNWSSAL.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene ZNF506
Supplier Page Shop

Product images